(data stored in ACNUC7421 zone)

EMBL: CP000075.PE31

CP000075.PE31        Location/Qualifiers
FT   CDS             35445..36269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0031"
FT                   /product="Alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35105"
FT                   /db_xref="GOA:Q500R7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q500R7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35105.1"
FT                   /translation="MPDLLIDGKTLHYSDQGTGPVVLLGHSYLWDKAMWSAQIDTLASQ
FT                   YRVIVPDLWGHGDSSGFPEGTRNLDDLARHALALLDHLNIERCNIVGLSVGGMWGAIAA
FT                   LLAPERITGLVLMDTYLGKETEAKKAYYFSLLDKLEEVGTFPEPLLDIVVPIFFRPGID
FT                   PQLPVYRSFRAALAGMNAEQLRQSVVPLGRMIFGRDDRLGLIEQLNADTTLVMCGDADI
FT                   PRPPEETREMASLIGCPYVLVPEAGHIANLENPAFVSGALMTFLARVNQKQG"
     MPDLLIDGKT LHYSDQGTGP VVLLGHSYLW DKAMWSAQID TLASQYRVIV PDLWGHGDSS        60
     GFPEGTRNLD DLARHALALL DHLNIERCNI VGLSVGGMWG AIAALLAPER ITGLVLMDTY       120
     LGKETEAKKA YYFSLLDKLE EVGTFPEPLL DIVVPIFFRP GIDPQLPVYR SFRAALAGMN       180
     AEQLRQSVVP LGRMIFGRDD RLGLIEQLNA DTTLVMCGDA DIPRPPEETR EMASLIGCPY       240
     VLVPEAGHIA NLENPAFVSG ALMTFLARVN QKQG                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page