(data stored in SCRATCH zone)

EMBL: CP000075.PE314

CP000075.PE314       Location/Qualifiers
FT   CDS             334005..334412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0314"
FT                   /product="Flagellar basal body-associated protein FliL"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35386"
FT                   /db_xref="GOA:Q4ZZN6"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZN6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35386.1"
FT                   /translation="MKAWILMLLALSLPVMAQEEAKEEGGPPKAAYVSLTPPFVGNYAL
FT                   DGGPKLRVYKADIALRVTGADAEAAVKRNDALIRNQLVSLFTQQTVDSMSSAEAKENIR
FT                   QEALKQVQRVMNDEEGKPIVEDLLFNNFIVQ"
     MKAWILMLLA LSLPVMAQEE AKEEGGPPKA AYVSLTPPFV GNYALDGGPK LRVYKADIAL        60
     RVTGADAEAA VKRNDALIRN QLVSLFTQQT VDSMSSAEAK ENIRQEALKQ VQRVMNDEEG       120
     KPIVEDLLFN NFIVQ                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page