(data stored in ACNUC7421 zone)

EMBL: CP000075.PE315

CP000075.PE315       Location/Qualifiers
FT   CDS             complement(334419..334868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0315"
FT                   /product="Protein of unknown function DUF589"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35387"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZN5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35387.1"
FT                   /translation="MAYWLMKSEPDEFSISDLQRLGKARWDGVRNYQARNFLRTMAEGD
FT                   KFFFYHSSCPEPGIAGIGKVARSAYPDPTALDPQSHYHDAKATEEKNPWSAIDVEFVDI
FT                   FKHVLGLGYLKQQSQLEQLPLVQKGSRLSVMPVTAEQWAAILALR"
     MAYWLMKSEP DEFSISDLQR LGKARWDGVR NYQARNFLRT MAEGDKFFFY HSSCPEPGIA        60
     GIGKVARSAY PDPTALDPQS HYHDAKATEE KNPWSAIDVE FVDIFKHVLG LGYLKQQSQL       120
     EQLPLVQKGS RLSVMPVTAE QWAAILALR                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page