(data stored in ACNUC7421 zone)

EMBL: CP000075.PE320

CP000075.PE320       Location/Qualifiers
FT   CDS             336861..337430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0320"
FT                   /product="Protein of unknown function UPF0149"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35392"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZN0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35392.1"
FT                   /translation="MPIQNSPYKAFATLLNSGGHKVSPAELHGLLLGRSCAGAGFDSEG
FT                   WFADASMLLETELLETEPQENIRAALVGLQEMVKGELTGDDMTVVLLLPGDDEPLTERA
FT                   AALGQWCQGFLAGFGLSIGDKVLGSEAKAVLEDLAAIAQVQDALEESEDGETDYMEVME
FT                   YMRVAPLLLFTEFNEPSAPQPKPSLH"
     MPIQNSPYKA FATLLNSGGH KVSPAELHGL LLGRSCAGAG FDSEGWFADA SMLLETELLE        60
     TEPQENIRAA LVGLQEMVKG ELTGDDMTVV LLLPGDDEPL TERAAALGQW CQGFLAGFGL       120
     SIGDKVLGSE AKAVLEDLAA IAQVQDALEE SEDGETDYME VMEYMRVAPL LLFTEFNEPS       180
     APQPKPSLH                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page