(data stored in ACNUC7421 zone)

EMBL: CP000075.PE326

CP000075.PE326       Location/Qualifiers
FT   CDS             345222..345803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0326"
FT                   /product="Protein of unknown function DUF1234"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35398"
FT                   /db_xref="GOA:Q4ZZM4"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZM4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35398.1"
FT                   /translation="MHNESIRYLIVPGWQGSPDDHWQTHWQNSLPNSTRVEQADWLKPR
FT                   REDWVGELQRTIAAHDTPVILIAHSLGCVTVAHWARLAPLETLRQVQGALLVAPADVER
FT                   PNCPPALRNFAPIPTDLLPFPTQIVSSDNDPAVSSQRAMEMARHWGAELGFLSQAGHIN
FT                   VKSGHQRWEQGFAYLYRLQNRLEQHARRRA"
     MHNESIRYLI VPGWQGSPDD HWQTHWQNSL PNSTRVEQAD WLKPRREDWV GELQRTIAAH        60
     DTPVILIAHS LGCVTVAHWA RLAPLETLRQ VQGALLVAPA DVERPNCPPA LRNFAPIPTD       120
     LLPFPTQIVS SDNDPAVSSQ RAMEMARHWG AELGFLSQAG HINVKSGHQR WEQGFAYLYR       180
     LQNRLEQHAR RRA                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page