(data stored in SCRATCH zone)

EMBL: CP000075.PE332

CP000075.PE332       Location/Qualifiers
FT   CDS             351980..353011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35404"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZL8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35404.1"
FT                   /translation="MKTSLQPNVDTPLDRDLQQSAMLKLAGHFHSLATGATQVPLQSLD
FT                   SHLRCEIQDPQVLDYHDRLISGAGPLFSHFLASVPYILEELARVGVALARFAQLNSRET
FT                   GQTFSLFEVDAFDGSNGRALAGHSHGLIQSFTSSPNAANQITFNRHADPALSLFFAQSV
FT                   FKVTGALLATPEYDRFRGGFDFIYEMAAFQFYTRDRVGQISHIKQFLKPGGLVFFLEKL
FT                   DHPDPEEYLLRERIKDEQFKTRYFSEEEIRWKRQQMLEYMQNGQVTLEALVSALCARFK
FT                   CVHLLWSSSNFCEFVASDDPQQLEQFLDLLGPTVQPADFCFERSRLGAIAPSQKGVVEF
FT                   GDA"
     MKTSLQPNVD TPLDRDLQQS AMLKLAGHFH SLATGATQVP LQSLDSHLRC EIQDPQVLDY        60
     HDRLISGAGP LFSHFLASVP YILEELARVG VALARFAQLN SRETGQTFSL FEVDAFDGSN       120
     GRALAGHSHG LIQSFTSSPN AANQITFNRH ADPALSLFFA QSVFKVTGAL LATPEYDRFR       180
     GGFDFIYEMA AFQFYTRDRV GQISHIKQFL KPGGLVFFLE KLDHPDPEEY LLRERIKDEQ       240
     FKTRYFSEEE IRWKRQQMLE YMQNGQVTLE ALVSALCARF KCVHLLWSSS NFCEFVASDD       300
     PQQLEQFLDL LGPTVQPADF CFERSRLGAI APSQKGVVEF GDA                         343
//

If you have problems or comments...

PBIL Back to PBIL home page