(data stored in ACNUC7421 zone)

EMBL: CP000075.PE335

CP000075.PE335       Location/Qualifiers
FT   CDS             354656..355882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0335"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35407"
FT                   /db_xref="GOA:Q4ZZL5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZL5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35407.1"
FT                   /translation="MRKDYLAFFISLFLSRLADQILLFIVPLVVFQTTNSASWAGLAFF
FT                   VESLPRFLAFPLCGALCDKYPPVKILHISQIYRASLCVLAMVLYAIFGGIGWLVVLSAL
FT                   CGVLTTQGIMAREVLMPYIFQHYSYTRTLSYSQIADQSGLVLGPLVAALMLEVWAWHWV
FT                   VLLTAGLFLLADLSMLAWQRLSRITLEVFEQHQDIWLQPLRIAFGHIRSLAELKKIITL
FT                   AVGVNLIVGVTLATSAAMVIGEYSAGKDSYAGLQAAGAVTTIVILFFLARVALPMRVLG
FT                   GVGFSMIATGAFISALSPNLIGYALGFLLIVGFDKMFNVYMRTLRQRVIPPQDFGKTVG
FT                   VITLLNNLSQPLAGLLVALLAAPLGIRQVILMLAMLTSVIGAGALWWFAKARSPFPTRI
FT                   VEADREAGK"
     MRKDYLAFFI SLFLSRLADQ ILLFIVPLVV FQTTNSASWA GLAFFVESLP RFLAFPLCGA        60
     LCDKYPPVKI LHISQIYRAS LCVLAMVLYA IFGGIGWLVV LSALCGVLTT QGIMAREVLM       120
     PYIFQHYSYT RTLSYSQIAD QSGLVLGPLV AALMLEVWAW HWVVLLTAGL FLLADLSMLA       180
     WQRLSRITLE VFEQHQDIWL QPLRIAFGHI RSLAELKKII TLAVGVNLIV GVTLATSAAM       240
     VIGEYSAGKD SYAGLQAAGA VTTIVILFFL ARVALPMRVL GGVGFSMIAT GAFISALSPN       300
     LIGYALGFLL IVGFDKMFNV YMRTLRQRVI PPQDFGKTVG VITLLNNLSQ PLAGLLVALL       360
     AAPLGIRQVI LMLAMLTSVI GAGALWWFAK ARSPFPTRIV EADREAGK                    408
//

If you have problems or comments...

PBIL Back to PBIL home page