(data stored in ACNUC7421 zone)

EMBL: CP000075.PE342

CP000075.PE342       Location/Qualifiers
FT   CDS             364205..365200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35414"
FT                   /db_xref="GOA:Q4ZZK8"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35414.1"
FT                   /translation="MRQQTTPCRYRYDALDRLATRTPVGGSIARSFYQSDTLASEIQDA
FT                   EHLRFLHHDRQLLATQSALATLLIGSDQQHSVLHTVSAGLPAAIAYTPYGHRQALNPLP
FT                   GFNGERPDPLTGHYLLGNGYRAYNPVLMRFNSPDSLSPFGNGGVNAYGYCAGDPVNRSD
FT                   PTGHGLIDDVQTYIYLGTALVTGVFGLLTARSSIKAVIKGVKLDPEANAVDNALSQTSA
FT                   LRRPATTVEKVSAAIGVGALIASATWTASYIAGKFERDSLAARTLRSVAIVVVVPVLGF
FT                   RGWTYYRSRLPARSAKKASMSKRSSTGSDRIRSSRSSIRNDDPEIEITPL"
     MRQQTTPCRY RYDALDRLAT RTPVGGSIAR SFYQSDTLAS EIQDAEHLRF LHHDRQLLAT        60
     QSALATLLIG SDQQHSVLHT VSAGLPAAIA YTPYGHRQAL NPLPGFNGER PDPLTGHYLL       120
     GNGYRAYNPV LMRFNSPDSL SPFGNGGVNA YGYCAGDPVN RSDPTGHGLI DDVQTYIYLG       180
     TALVTGVFGL LTARSSIKAV IKGVKLDPEA NAVDNALSQT SALRRPATTV EKVSAAIGVG       240
     ALIASATWTA SYIAGKFERD SLAARTLRSV AIVVVVPVLG FRGWTYYRSR LPARSAKKAS       300
     MSKRSSTGSD RIRSSRSSIR NDDPEIEITP L                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page