(data stored in SCRATCH zone)

EMBL: CP000075.PE343

CP000075.PE343       Location/Qualifiers
FT   CDS             365313..366428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35415"
FT                   /db_xref="GOA:Q4ZZK7"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZK7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35415.1"
FT                   /translation="MAILCKYTYDPLDRVSTLTPLAQAVANRFYNGEQLMTELQGGRQR
FT                   TCVRAGGQLLAQQLREGDEVVTTMIAGDRNNSVLHASEAGQQSDVVYTPFGHHQAVQAS
FT                   AELPGFNGEQPDPLTGHYLLGNGYRAYNPVLMRFNSPDSMSPFGKGGLNAYAYCVGDPV
FT                   NRVDPTGHFSALAALISGIVLSAAGAGAIATAAGLKDSDSTLGTTLTVVGSISLMAGLG
FT                   AFATTGFKLKQTSVKLKQMRAKIKTGKREASDLASARKQSSARHAEALTRQADELTRHA
FT                   DELKGPPASSDSALTFRLELMEADVMKNGPYDYYSSSFLDPVMLNKIRDKDAKRVVVLD
FT                   STSRPPGLLTLTRIDDGQTLRTKAHAIREIT"
     MAILCKYTYD PLDRVSTLTP LAQAVANRFY NGEQLMTELQ GGRQRTCVRA GGQLLAQQLR        60
     EGDEVVTTMI AGDRNNSVLH ASEAGQQSDV VYTPFGHHQA VQASAELPGF NGEQPDPLTG       120
     HYLLGNGYRA YNPVLMRFNS PDSMSPFGKG GLNAYAYCVG DPVNRVDPTG HFSALAALIS       180
     GIVLSAAGAG AIATAAGLKD SDSTLGTTLT VVGSISLMAG LGAFATTGFK LKQTSVKLKQ       240
     MRAKIKTGKR EASDLASARK QSSARHAEAL TRQADELTRH ADELKGPPAS SDSALTFRLE       300
     LMEADVMKNG PYDYYSSSFL DPVMLNKIRD KDAKRVVVLD STSRPPGLLT LTRIDDGQTL       360
     RTKAHAIREI T                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page