(data stored in ACNUC7421 zone)

EMBL: CP000075.PE344

CP000075.PE344       Location/Qualifiers
FT   CDS             366781..367899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0344"
FT                   /product="Secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35416"
FT                   /db_xref="GOA:Q4ZZK6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZK6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35416.1"
FT                   /translation="MPVRISRLVTFGLAAALAALAGCGEEKPAAPELPRVYVQTVKSAD
FT                   FAASVALTGDVQARVQTRLSFRVNGKIIQRNVDVGDRVTARQVLARLDPKDLQTNVDSA
FT                   AAAVAAEQARVSQSRAAFVRQQKLLPKGYTSRSEYDSAQAAVRGSESSLKAAQAQLANA
FT                   REQLGYTALVADAPGVITARQAEVGQVVQATMPIFDLARDGDRDAVFNVYESLFVQPPT
FT                   NQAVQVTLLDNPNIKVSGKVREVTPAVSAQTGTLQIKIALDPLPEGMDLGSVVSVALSA
FT                   PANASVELPWAALTKDLGEQLGKPAVWVVDEQGKVNLRKVTVTRYLTSKVIIGDGLKSG
FT                   EKVVVAGGQLLHPDMQVDIAEQPKPQNAQVQP"
     MPVRISRLVT FGLAAALAAL AGCGEEKPAA PELPRVYVQT VKSADFAASV ALTGDVQARV        60
     QTRLSFRVNG KIIQRNVDVG DRVTARQVLA RLDPKDLQTN VDSAAAAVAA EQARVSQSRA       120
     AFVRQQKLLP KGYTSRSEYD SAQAAVRGSE SSLKAAQAQL ANAREQLGYT ALVADAPGVI       180
     TARQAEVGQV VQATMPIFDL ARDGDRDAVF NVYESLFVQP PTNQAVQVTL LDNPNIKVSG       240
     KVREVTPAVS AQTGTLQIKI ALDPLPEGMD LGSVVSVALS APANASVELP WAALTKDLGE       300
     QLGKPAVWVV DEQGKVNLRK VTVTRYLTSK VIIGDGLKSG EKVVVAGGQL LHPDMQVDIA       360
     EQPKPQNAQV QP                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page