(data stored in SCRATCH zone)

EMBL: CP000075.PE345

CP000075.PE345       Location/Qualifiers
FT   CDS             367896..368981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0345"
FT                   /product="Secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35417"
FT                   /db_xref="GOA:Q4ZZK5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35417.1"
FT                   /translation="MKRRSCLLLGSLLLSGVLLSGCGKDEAPPEPVRPVVFVEVRPESN
FT                   QDFGRFAGNIQARYQSVLGFRVAGRIARRDVDVGAEVKKGDLLATLDPTDQQNTVRARQ
FT                   GDLANVQAQLINAQANARRQQELFDRGVGAQAQLDIALTDLKTASSSQEQAKAAAQQAR
FT                   DQLSYSELRSDHDAVVTEWKVEAGQVVTAGQEVVTLAQPDIKEAVIDLPDTLADQLPSD
FT                   VVFTVASQLNPEVNTTATIREIEPQADRTTRTRRARLSLAQTPAAFRLGTAISVTLSST
FT                   ITPRMRLPINALQEVDGKRQVWIVDSQSQTVNPRAVTIASRDSDSFVLTDGVKAGEKVV
FT                   SAGVNSLKPGQKVKVDEESPR"
     MKRRSCLLLG SLLLSGVLLS GCGKDEAPPE PVRPVVFVEV RPESNQDFGR FAGNIQARYQ        60
     SVLGFRVAGR IARRDVDVGA EVKKGDLLAT LDPTDQQNTV RARQGDLANV QAQLINAQAN       120
     ARRQQELFDR GVGAQAQLDI ALTDLKTASS SQEQAKAAAQ QARDQLSYSE LRSDHDAVVT       180
     EWKVEAGQVV TAGQEVVTLA QPDIKEAVID LPDTLADQLP SDVVFTVASQ LNPEVNTTAT       240
     IREIEPQADR TTRTRRARLS LAQTPAAFRL GTAISVTLSS TITPRMRLPI NALQEVDGKR       300
     QVWIVDSQSQ TVNPRAVTIA SRDSDSFVLT DGVKAGEKVV SAGVNSLKPG QKVKVDEESP       360
     R                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page