(data stored in ACNUC7421 zone)

EMBL: CP000075.PE346

CP000075.PE346       Location/Qualifiers
FT   CDS             368978..372079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0346"
FT                   /product="Acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35418"
FT                   /db_xref="GOA:Q4ZZK4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35418.1"
FT                   /translation="MKGNFNLSEWAIKHQSFVWYLMFVALLMGVFSYMKLGREEDPSFT
FT                   IKTMIIQTRWPGATVDETLEQVTDRIEKKLEELDSLDYVKSYTRPGESTVFVYLRDTTS
FT                   AKAIPEIWYQVRKKVDDIRGQFPQGLQGPSFNDEFGDVYGSIYAFTADGFSMRQLRDYV
FT                   EKVRADIRDVPGLGKVEMIGQQDEVVYLNFSTRKLAALGIDQSQVVQSLQSQNAVTPAG
FT                   VIEAGPERISVRTSGQFASEKDLAAVNLRINDRFYRLSDIADITRGYTDPPKPLFRFDG
FT                   KPAIGLAIAMQKGGNIQSFGKALHERMDATTAELPVGIGVHKVSDQAEVVNKAVGGFTS
FT                   ALFEAVIIVLLVSFVSLGFRAGLVVACSIPLVLAMVFVFMEYSGITMQRISLGALIIAL
FT                   GLLVDDAMITVEMMVTRLEMGESKEQAATYAYTSTAFPMLTGTLVTVAGFVPIGLNNSS
FT                   AGEYTFTLFAVIAVAMLVSWVVAVLFAPVIGVHILSANIKPKSEEPGRIGRAFNGSMLW
FT                   AMRHRWLAIAITVGLFAASLFSMQFVQNQFFPSSDRPEILVDLNLPQNASINETRKVVD
FT                   RFEASLNDDPDIERWSTYIGQGALRFYLPLDQQLENPFYAQLVIVSKGLEERGALTARL
FT                   QKRLRDDFVGIGSYVQALEMGPPVGRPLQYRVSGENIDKVRQHAIELATLLDHNPHVGE
FT                   VIYDWNEPGKVLRIDINQDKARQLGLSSEDVAKLMNSVVSGSTVTQVRDDIYLINVVGR
FT                   AEDAERGTPETLQNLQIVTPTGTSIPLLAFATVGYELEQPLVWRRDRKPTITVKGAVRD
FT                   AIQPTDLVKQLQPEIDKFAAGLPVGYKVATGGTVEESSKAQGPIASVAPLMLFLMATFL
FT                   MIQLHSIQKMFLVASVAPLGLIGVVLALIPTGTPLGFVAILGVLALIGIIIRNSVILVT
FT                   QIDAYEKSGYLPWDAVVEATEHRRRPILLTAAAASLGMIPIAREVFWGPMAYAMIGGII
FT                   IATLLTLLFLPALYVAWYRIKEPTDEQRREAADKDEGEHAQPAH"
     MKGNFNLSEW AIKHQSFVWY LMFVALLMGV FSYMKLGREE DPSFTIKTMI IQTRWPGATV        60
     DETLEQVTDR IEKKLEELDS LDYVKSYTRP GESTVFVYLR DTTSAKAIPE IWYQVRKKVD       120
     DIRGQFPQGL QGPSFNDEFG DVYGSIYAFT ADGFSMRQLR DYVEKVRADI RDVPGLGKVE       180
     MIGQQDEVVY LNFSTRKLAA LGIDQSQVVQ SLQSQNAVTP AGVIEAGPER ISVRTSGQFA       240
     SEKDLAAVNL RINDRFYRLS DIADITRGYT DPPKPLFRFD GKPAIGLAIA MQKGGNIQSF       300
     GKALHERMDA TTAELPVGIG VHKVSDQAEV VNKAVGGFTS ALFEAVIIVL LVSFVSLGFR       360
     AGLVVACSIP LVLAMVFVFM EYSGITMQRI SLGALIIALG LLVDDAMITV EMMVTRLEMG       420
     ESKEQAATYA YTSTAFPMLT GTLVTVAGFV PIGLNNSSAG EYTFTLFAVI AVAMLVSWVV       480
     AVLFAPVIGV HILSANIKPK SEEPGRIGRA FNGSMLWAMR HRWLAIAITV GLFAASLFSM       540
     QFVQNQFFPS SDRPEILVDL NLPQNASINE TRKVVDRFEA SLNDDPDIER WSTYIGQGAL       600
     RFYLPLDQQL ENPFYAQLVI VSKGLEERGA LTARLQKRLR DDFVGIGSYV QALEMGPPVG       660
     RPLQYRVSGE NIDKVRQHAI ELATLLDHNP HVGEVIYDWN EPGKVLRIDI NQDKARQLGL       720
     SSEDVAKLMN SVVSGSTVTQ VRDDIYLINV VGRAEDAERG TPETLQNLQI VTPTGTSIPL       780
     LAFATVGYEL EQPLVWRRDR KPTITVKGAV RDAIQPTDLV KQLQPEIDKF AAGLPVGYKV       840
     ATGGTVEESS KAQGPIASVA PLMLFLMATF LMIQLHSIQK MFLVASVAPL GLIGVVLALI       900
     PTGTPLGFVA ILGVLALIGI IIRNSVILVT QIDAYEKSGY LPWDAVVEAT EHRRRPILLT       960
     AAAASLGMIP IAREVFWGPM AYAMIGGIII ATLLTLLFLP ALYVAWYRIK EPTDEQRREA      1020
     ADKDEGEHAQ PAH                                                         1033
//

If you have problems or comments...

PBIL Back to PBIL home page