(data stored in SCRATCH zone)

EMBL: CP000075.PE348

CP000075.PE348       Location/Qualifiers
FT   CDS             complement(372774..373400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0348"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35420"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZK2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35420.1"
FT                   /translation="MKLDPQTLAQITAATLGNYNSVADDFRAGTRDHDVSQNIDALLRH
FT                   IEGPTPWQILDFGCGPGRDLKAFTAMGHVAVGLDGSERFAEMARAETGCEVVQQNFLEL
FT                   DLPQGRFDGLFANAVLFHIPKQELPRVLRQLHATLKPGGVLFSSNPRGENQEGWNGERY
FT                   GAYHDLESWRKLLTEAGFVELEHYYRPAGLPREQQPWLASVWRRQ"
     MKLDPQTLAQ ITAATLGNYN SVADDFRAGT RDHDVSQNID ALLRHIEGPT PWQILDFGCG        60
     PGRDLKAFTA MGHVAVGLDG SERFAEMARA ETGCEVVQQN FLELDLPQGR FDGLFANAVL       120
     FHIPKQELPR VLRQLHATLK PGGVLFSSNP RGENQEGWNG ERYGAYHDLE SWRKLLTEAG       180
     FVELEHYYRP AGLPREQQPW LASVWRRQ                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page