(data stored in ACNUC7421 zone)

EMBL: CP000075.PE35

CP000075.PE35        Location/Qualifiers
FT   CDS             39307..40263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0035"
FT                   /product="regulatory protein, LysR:LysR, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35109"
FT                   /db_xref="GOA:Q500R3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037418"
FT                   /db_xref="UniProtKB/TrEMBL:Q500R3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35109.1"
FT                   /translation="MKTDKIAATCQENSQIMSRDLPPLNALRAFESTARLGSVSQAAEQ
FT                   LNVTHGAVSRQLKVLEEHLGTSLFSKDGRGLKLTDAGIRLRDVSGDAFDRLRGVCAELS
FT                   RGSADAPFVLGCSGSLLARWFIPRLSRLNAELPDLRLHLSAGEGDLDPRRPGLDALLIF
FT                   AEPPWPADMQVFELASERIGPVLSPRFARFERLCDAPAEALLEESLLQTTSRPQAWPSW
FT                   AQQNGIDPQSLRYGQGFEHLYYLLEAAVAGLGIAIAPEPLVIDDLKAGRLAAPWGFSET
FT                   PAQLALWVPRRAADGRAQQLAQWLKNELKRSGEPIRN"
     MKTDKIAATC QENSQIMSRD LPPLNALRAF ESTARLGSVS QAAEQLNVTH GAVSRQLKVL        60
     EEHLGTSLFS KDGRGLKLTD AGIRLRDVSG DAFDRLRGVC AELSRGSADA PFVLGCSGSL       120
     LARWFIPRLS RLNAELPDLR LHLSAGEGDL DPRRPGLDAL LIFAEPPWPA DMQVFELASE       180
     RIGPVLSPRF ARFERLCDAP AEALLEESLL QTTSRPQAWP SWAQQNGIDP QSLRYGQGFE       240
     HLYYLLEAAV AGLGIAIAPE PLVIDDLKAG RLAAPWGFSE TPAQLALWVP RRAADGRAQQ       300
     LAQWLKNELK RSGEPIRN                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page