(data stored in ACNUC7421 zone)

EMBL: CP000075.PE355

CP000075.PE355       Location/Qualifiers
FT   CDS             complement(380690..381409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35427"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZJ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35427.1"
FT                   /translation="MSQNTCKASPMSLPIPAVPLASRHGIGVRNASQLVVHVDPYGSME
FT                   EGDLIELFWDGCYVASTILKASDVGKPVVLRVPESFLQNGKARTYYRVMKIGGVPVTSP
FT                   CRKLWVKLDAPGGLLVSASTEENQGLAPLYVAPSVIRHGLSRRHLEGGLPMTIEPYLNM
FT                   AVHDEITIRWGDLRMDLPPLTADDIGEPVDLVVPPELIREGGDEQRLEVSYCVIDRVGN
FT                   NSLWAPPRIIRIQPLGH"
     MSQNTCKASP MSLPIPAVPL ASRHGIGVRN ASQLVVHVDP YGSMEEGDLI ELFWDGCYVA        60
     STILKASDVG KPVVLRVPES FLQNGKARTY YRVMKIGGVP VTSPCRKLWV KLDAPGGLLV       120
     SASTEENQGL APLYVAPSVI RHGLSRRHLE GGLPMTIEPY LNMAVHDEIT IRWGDLRMDL       180
     PPLTADDIGE PVDLVVPPEL IREGGDEQRL EVSYCVIDRV GNNSLWAPPR IIRIQPLGH        239
//

If you have problems or comments...

PBIL Back to PBIL home page