(data stored in ACNUC7421 zone)

EMBL: CP000075.PE357

CP000075.PE357       Location/Qualifiers
FT   CDS             complement(382734..383402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0357"
FT                   /product="Diaminopimelate ABC transporter membrane protein
FT                   / L-cystine ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35429"
FT                   /db_xref="GOA:Q4ZZJ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZJ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35429.1"
FT                   /translation="MIEESLQLALDSAPFLLKGAYYTVFLSLGGMFFGLLLGFGLALMR
FT                   LSRIKPVNWIARIYVSFFRGTPLLVQLFVIYYGLPELGIQLEPLSAALIGFSLNMAAYA
FT                   CEILRAAISSVERGQWEAAASIGMTRWQTMRRAILPQAARTALPPLGNSFISLVKDTAL
FT                   AATIQVPELFRQAQLITARTFEIFTMYLAAALIYWILATALSHLQNKLEARVNRHDLET
FT                   "
     MIEESLQLAL DSAPFLLKGA YYTVFLSLGG MFFGLLLGFG LALMRLSRIK PVNWIARIYV        60
     SFFRGTPLLV QLFVIYYGLP ELGIQLEPLS AALIGFSLNM AAYACEILRA AISSVERGQW       120
     EAAASIGMTR WQTMRRAILP QAARTALPPL GNSFISLVKD TALAATIQVP ELFRQAQLIT       180
     ARTFEIFTMY LAAALIYWIL ATALSHLQNK LEARVNRHDL ET                          222
//

If you have problems or comments...

PBIL Back to PBIL home page