(data stored in ACNUC7421 zone)

EMBL: CP000075.PE358

CP000075.PE358       Location/Qualifiers
FT   CDS             complement(383399..384196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0358"
FT                   /product="Diaminopimelate-binding protein /
FT                   L-cystine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35430"
FT                   /db_xref="GOA:Q4ZZJ2"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZJ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35430.1"
FT                   /translation="MNISAIRRTFLFSAMGLMLSAGIAGQAMAGEQLQKIKDSGTLNVG
FT                   LEGTYPPFSFVDESGKLTGFEVEFSEALAKELGVKAKIQPSKWDGILAALDSKRLDVVI
FT                   NQVTISDERKKKYDFSEPYTISGIQALVLKKNADTIKSVKDLSGKKVGVGLGTNYEEWL
FT                   KANVPDAIVKTYDDDPSKIQDLSVGRIDAILVDRLAALEMAAKTKNKLVPAGEAFSRQA
FT                   SGIALRKGEPELLAAIDKAIDKLRADGTLKKLSEKYFNADVTQ"
     MNISAIRRTF LFSAMGLMLS AGIAGQAMAG EQLQKIKDSG TLNVGLEGTY PPFSFVDESG        60
     KLTGFEVEFS EALAKELGVK AKIQPSKWDG ILAALDSKRL DVVINQVTIS DERKKKYDFS       120
     EPYTISGIQA LVLKKNADTI KSVKDLSGKK VGVGLGTNYE EWLKANVPDA IVKTYDDDPS       180
     KIQDLSVGRI DAILVDRLAA LEMAAKTKNK LVPAGEAFSR QASGIALRKG EPELLAAIDK       240
     AIDKLRADGT LKKLSEKYFN ADVTQ                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page