(data stored in SCRATCH zone)

EMBL: CP000075.PE36

CP000075.PE36        Location/Qualifiers
FT   CDS             complement(40264..40590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0036"
FT                   /product="protein of unknown function DUF883"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35110"
FT                   /db_xref="GOA:Q500R2"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:Q500R2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35110.1"
FT                   /translation="MATTSLRKASLQSMEAEIESLLKSLEGLKADATDESRKTLKNLKA
FT                   NAESALSHSRSLLSDVYEDVKEKTRENALATRDYAQEHPWTTAGVAVGAIGLIAAYMLF
FT                   KRGN"
     MATTSLRKAS LQSMEAEIES LLKSLEGLKA DATDESRKTL KNLKANAESA LSHSRSLLSD        60
     VYEDVKEKTR ENALATRDYA QEHPWTTAGV AVGAIGLIAA YMLFKRGN                    108
//

If you have problems or comments...

PBIL Back to PBIL home page