(data stored in ACNUC7421 zone)

EMBL: CP000075.PE363

CP000075.PE363       Location/Qualifiers
FT   CDS             complement(387952..388485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35435"
FT                   /db_xref="InterPro:IPR021851"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZI7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35435.1"
FT                   /translation="MNAKRLLCLAGTTLAFTCLSSVAMAQTDLPESVRVPAGNKVGMQT
FT                   TGVGEITYECRAKANMPNEMEWAFVGPKAVLNDKSGKQVGTYYGPPATWEAKDGSKITG
FT                   TQVAVAPSSTGNLPYQLVKANPAEGKGAMTGVTYIQRVALKGGVAPAKACAESNKGAKE
FT                   VVKYQADYLFWTAG"
     MNAKRLLCLA GTTLAFTCLS SVAMAQTDLP ESVRVPAGNK VGMQTTGVGE ITYECRAKAN        60
     MPNEMEWAFV GPKAVLNDKS GKQVGTYYGP PATWEAKDGS KITGTQVAVA PSSTGNLPYQ       120
     LVKANPAEGK GAMTGVTYIQ RVALKGGVAP AKACAESNKG AKEVVKYQAD YLFWTAG          177
//

If you have problems or comments...

PBIL Back to PBIL home page