(data stored in ACNUC7421 zone)

EMBL: CP000075.PE371

CP000075.PE371       Location/Qualifiers
FT   CDS             complement(395102..396481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0371"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35443"
FT                   /db_xref="GOA:Q4ZZH9"
FT                   /db_xref="InterPro:IPR025060"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZH9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35443.1"
FT                   /translation="MRKPFLSHPAMKIAVLGLALCTAITALAQDKPADFASQTPLSLSG
FT                   QGPWYRIELPLAVQLNARQTDLSDVRVFNAEGQPQAYSIRPRQPAPEQEPTPIEVNWFA
FT                   LYSTQEAGDTAPVIRIERSSNGSVIEVQPQSDIEAGEEVLRGWLLDTSAIKAPLEQLVI
FT                   DWSTEREGFQNFSIEASDDLQHWRNWGEGQVARLSFADEVVEQREVGLPGQSARYLRLL
FT                   WRSPHSAPLLISAHLLSASSGTPASPLTWSPPVQGSVESPNEYVWQLPTGLPIGRVKID
FT                   IAQPNSLAPATLYGRLDAGQPWQPISSGLLYRLSQNNSDVLQDQLQLSGRIVQQLKLVV
FT                   DDRGGGLGNEAPQLSVAVPATEVVFLARGDGPFTLAIGNPSVKAANLSLATLIPDLSAE
FT                   KLATLGTASPATATVANMAAAPIAVPQGTDFKRLGLWAVLLLGVVFLGWMTFSTLRAAK
FT                   R"
     MRKPFLSHPA MKIAVLGLAL CTAITALAQD KPADFASQTP LSLSGQGPWY RIELPLAVQL        60
     NARQTDLSDV RVFNAEGQPQ AYSIRPRQPA PEQEPTPIEV NWFALYSTQE AGDTAPVIRI       120
     ERSSNGSVIE VQPQSDIEAG EEVLRGWLLD TSAIKAPLEQ LVIDWSTERE GFQNFSIEAS       180
     DDLQHWRNWG EGQVARLSFA DEVVEQREVG LPGQSARYLR LLWRSPHSAP LLISAHLLSA       240
     SSGTPASPLT WSPPVQGSVE SPNEYVWQLP TGLPIGRVKI DIAQPNSLAP ATLYGRLDAG       300
     QPWQPISSGL LYRLSQNNSD VLQDQLQLSG RIVQQLKLVV DDRGGGLGNE APQLSVAVPA       360
     TEVVFLARGD GPFTLAIGNP SVKAANLSLA TLIPDLSAEK LATLGTASPA TATVANMAAA       420
     PIAVPQGTDF KRLGLWAVLL LGVVFLGWMT FSTLRAAKR                              459
//

If you have problems or comments...

PBIL Back to PBIL home page