(data stored in ACNUC7421 zone)

EMBL: CP000075.PE377

CP000075.PE377       Location/Qualifiers
FT   CDS             402055..403983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0377"
FT                   /product="Periplasmic glucan biosynthesis protein, MdoG"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35447"
FT                   /db_xref="GOA:Q4ZZH5"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR023704"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZH5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35447.1"
FT                   /translation="MIVSPCDAPKTPVKRLRSALLASSALVCLFSAGQLWAFNLDDVAA
FT                   KAKEMAGQKFEAPRSNLPNELRDMKFADYQKIRFRDDKAEWAGEKTPFKVSFYHQGMHF
FT                   DTPVKINEVTATSVDEIKYDPNRFDFGDLKIDPKSTEKLGYAGFRVLYPINKDDKQDEI
FT                   MTMLGASYFRVIGKGQVYGLSARGMAIDTASPSGEEFPRFKEFWIEKPGPDDNHLVIFA
FT                   LLDSPRATGAYQLTLRPGTNTLVDVKSRMFLRDKVNKLGVAPLTSMFLFGANQPSRVPN
FT                   YRRELHDSSGLSIQAANGEWLWRPLNNPKHLSISSFSVENPRGFGLLQRGRDFSQYEDL
FT                   DDRYDKRPSAWIEPKGDWGKGTVELVEIPTADETNDNIVAYWKPETLAEPGQEMAFDYR
FT                   LHWTMQENSIHSPDLGWVKQTQRSIGDVRQSNLIRQPDGSLAFLVDFVGPVLAALPEDK
FT                   TIRSQVTTDDNVELVENNLRYNPVTKGYRLTLRVKVKDSSKPTEMRAYLLREIPAEPGK
FT                   EPALLVADKAEEKKAAAKEAAKPAVSKESANDQVEIAKADAPKPEAAKPETAKSEAGKA
FT                   DAAKGKGEVAKADAGKADASKAEAAKDKDGKEIQQPETEAAPTHPEPAKTLQVMTETWS
FT                   YQLPSDE"
     MIVSPCDAPK TPVKRLRSAL LASSALVCLF SAGQLWAFNL DDVAAKAKEM AGQKFEAPRS        60
     NLPNELRDMK FADYQKIRFR DDKAEWAGEK TPFKVSFYHQ GMHFDTPVKI NEVTATSVDE       120
     IKYDPNRFDF GDLKIDPKST EKLGYAGFRV LYPINKDDKQ DEIMTMLGAS YFRVIGKGQV       180
     YGLSARGMAI DTASPSGEEF PRFKEFWIEK PGPDDNHLVI FALLDSPRAT GAYQLTLRPG       240
     TNTLVDVKSR MFLRDKVNKL GVAPLTSMFL FGANQPSRVP NYRRELHDSS GLSIQAANGE       300
     WLWRPLNNPK HLSISSFSVE NPRGFGLLQR GRDFSQYEDL DDRYDKRPSA WIEPKGDWGK       360
     GTVELVEIPT ADETNDNIVA YWKPETLAEP GQEMAFDYRL HWTMQENSIH SPDLGWVKQT       420
     QRSIGDVRQS NLIRQPDGSL AFLVDFVGPV LAALPEDKTI RSQVTTDDNV ELVENNLRYN       480
     PVTKGYRLTL RVKVKDSSKP TEMRAYLLRE IPAEPGKEPA LLVADKAEEK KAAAKEAAKP       540
     AVSKESANDQ VEIAKADAPK PEAAKPETAK SEAGKADAAK GKGEVAKADA GKADASKAEA       600
     AKDKDGKEIQ QPETEAAPTH PEPAKTLQVM TETWSYQLPS DE                          642
//

If you have problems or comments...

PBIL Back to PBIL home page