(data stored in ACNUC7421 zone)

EMBL: CP000075.PE380

CP000075.PE380       Location/Qualifiers
FT   CDS             complement(410246..412162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0380"
FT                   /product="Histidine kinase, HAMP region:Bacterial
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35450"
FT                   /db_xref="GOA:Q4ZZH2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZH2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35450.1"
FT                   /translation="MSRGLSKSLANASVSLKLAIGFGLVLLMTLMISATGWFSNQALID
FT                   RGDRVTAIAEVNELTLQLRINRMSYEVLYNAETAAKVRSTLDELDAALQTARNLLRSPE
FT                   NLQLLDVQIQATRDYRQSFEDMSKAIDTREASRSQMGENADKAVDQANRIEAELLKEDN
FT                   ILAFNGIVGVSKLIQQARFQVRGYTYSGRPDFEKDANKAIDDAVTGINTLAGDISSTYS
FT                   PMLQQAIAGLNGYRAAVGKYRDAQAASKAALDKMTTLGVSMLATSNDLITRQNKSRDAD
FT                   SAKSVQMIIAATALAMVLGILAAWVITRQITTPLQETLEVVERVASGDLSRNLNVDRKD
FT                   ELGKLQATIQRMTVSLRELVGGIRDGVTQIASAAEELSAVTEQTSAGVNSQKVETDQVA
FT                   TAMHEMTATVQEVARNAEEASEAAVAADRQARDGERVVNEAIAQIERLASAVGNSSEAM
FT                   GALKQESDKIGSVLDVIKSVAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRSLAQRT
FT                   QKSTEEIEALIARLQSGTQQATTVMDSSRELSTSSVELTRRAGGSLANITKTVSSIQAM
FT                   NQQIAAAAEEQSATAEEINRSIINVRDVSEQTSAASEETAASSVELARLGNHLQVLVSR
FT                   FTV"
     MSRGLSKSLA NASVSLKLAI GFGLVLLMTL MISATGWFSN QALIDRGDRV TAIAEVNELT        60
     LQLRINRMSY EVLYNAETAA KVRSTLDELD AALQTARNLL RSPENLQLLD VQIQATRDYR       120
     QSFEDMSKAI DTREASRSQM GENADKAVDQ ANRIEAELLK EDNILAFNGI VGVSKLIQQA       180
     RFQVRGYTYS GRPDFEKDAN KAIDDAVTGI NTLAGDISST YSPMLQQAIA GLNGYRAAVG       240
     KYRDAQAASK AALDKMTTLG VSMLATSNDL ITRQNKSRDA DSAKSVQMII AATALAMVLG       300
     ILAAWVITRQ ITTPLQETLE VVERVASGDL SRNLNVDRKD ELGKLQATIQ RMTVSLRELV       360
     GGIRDGVTQI ASAAEELSAV TEQTSAGVNS QKVETDQVAT AMHEMTATVQ EVARNAEEAS       420
     EAAVAADRQA RDGERVVNEA IAQIERLASA VGNSSEAMGA LKQESDKIGS VLDVIKSVAE       480
     QTNLLALNAA IEAARAGEAG RGFAVVADEV RSLAQRTQKS TEEIEALIAR LQSGTQQATT       540
     VMDSSRELST SSVELTRRAG GSLANITKTV SSIQAMNQQI AAAAEEQSAT AEEINRSIIN       600
     VRDVSEQTSA ASEETAASSV ELARLGNHLQ VLVSRFTV                               638
//

If you have problems or comments...

PBIL Back to PBIL home page