(data stored in ACNUC7421 zone)

EMBL: CP000075.PE384

CP000075.PE384       Location/Qualifiers
FT   CDS             complement(414233..414508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0384"
FT                   /product="Twin-arginine translocation protein TatA/E"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35454"
FT                   /db_xref="GOA:Q4ZZG8"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZG8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35454.1"
FT                   /translation="MGIFDWKHWIVILIVVVLVFGTKKLKGLGSDVGESIKGFRKAMND
FT                   DDKPAEQPAPQPQQAQPAPQGSPLNQPHTIDAQAHKVDEPIRKDQV"
     MGIFDWKHWI VILIVVVLVF GTKKLKGLGS DVGESIKGFR KAMNDDDKPA EQPAPQPQQA        60
     QPAPQGSPLN QPHTIDAQAH KVDEPIRKDQ V                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page