(data stored in ACNUC7421 zone)

EMBL: CP000075.PE392

CP000075.PE392       Location/Qualifiers
FT   CDS             419859..420164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35462"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZG0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35462.1"
FT                   /translation="MGMYFVTLRVTNLRRTALSGQDAERPERHTHAEHGHDDVLAGTYR
FT                   SSRSSVGMYFMTLRVTDQRRATCSREDAERPERHAHAAHRHNGVHADTCRRIRASV"
     MGMYFVTLRV TNLRRTALSG QDAERPERHT HAEHGHDDVL AGTYRSSRSS VGMYFMTLRV        60
     TDQRRATCSR EDAERPERHA HAAHRHNGVH ADTCRRIRAS V                           101
//

If you have problems or comments...

PBIL Back to PBIL home page