(data stored in ACNUC7421 zone)

EMBL: CP000075.PE399

CP000075.PE399       Location/Qualifiers
FT   CDS             427900..428121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0399"
FT                   /product="LSU ribosomal protein L31P"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35469"
FT                   /db_xref="GOA:Q4ZZF3"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZF3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35469.1"
FT                   /translation="MKADIHPVYEAIDATCSCGNVIKTRSTLAAPLSLDVCNECHPFYT
FT                   GKQKMLDVGGRVDKFKSRFGAFGATKAK"
     MKADIHPVYE AIDATCSCGN VIKTRSTLAA PLSLDVCNEC HPFYTGKQKM LDVGGRVDKF        60
     KSRFGAFGAT KAK                                                           73
//

If you have problems or comments...

PBIL Back to PBIL home page