(data stored in ACNUC7421 zone)

EMBL: CP000075.PE4

CP000075.PE4         Location/Qualifiers
FT   CDS             3809..6226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35078"
FT                   /db_xref="GOA:Q500U4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q500U4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35078.1"
FT                   /translation="MSENQTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFEV
FT                   VDNSIDEALAGHCDDISIIIHPDESITVRDNGRGIPVDVHKEEGVSAAEVIMTVLHAGG
FT                   KFDDNSYKVSGGLHGVGVSVVNALSELLLLTVRRSGKIWEQTYVHGVPQEPMKIVGESD
FT                   STGTQIHFKPSAETFKNIHFSWDILAKRIRELSFLNSGVGIVLKDERSGKEELFKYEGG
FT                   LRAFVEYLNTNKTPVNEVFHFNIQRDDGIGVEIALQWNDSFNENLLCFTNNIPQRDGGT
FT                   HLVGFRSALTRNLNNYIEQEGLAKKHKVATTGDDAREGLTAIISVKVPDPKFSSQTKDK
FT                   LVSSEVKTAVEQEMGKYFSDFLLENPNEAKAVVGKMIDAARAREAARKAREMTRRKGAL
FT                   DIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRRTQAILPLKGKILNVEKAR
FT                   FDKMISSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHIRTLLLTFFFR
FT                   QLPELIERGYIYIAQPPLYKVKKGKQEQYIKDDEAMEEYMTQSALEDASLHLSESAPGI
FT                   SGTALEKLVNDFRMVMKTLKRLSRLYPQELTEHFVYLPPITLEQLSDHEGMQAWLALFD
FT                   ARLRTGEKSGLVYKASLREDRERNVWLPEVELISHGLSNYVTFNRDFFGSNDYKTVTAL
FT                   GAQISTLLEEGAYVQRGERKKPVNEFKEALAWLMAESTKRHTIQRYKGLGEMNPDQLWE
FT                   TTMDPSVRRMLKVTIEDAIGADQIFNTLMGDAVEPRRDFIESNALAVSNLDF"
     MSENQTYDSS SIKVLKGLDA VRKRPGMYIG DTDDGSGLHH MVFEVVDNSI DEALAGHCDD        60
     ISIIIHPDES ITVRDNGRGI PVDVHKEEGV SAAEVIMTVL HAGGKFDDNS YKVSGGLHGV       120
     GVSVVNALSE LLLLTVRRSG KIWEQTYVHG VPQEPMKIVG ESDSTGTQIH FKPSAETFKN       180
     IHFSWDILAK RIRELSFLNS GVGIVLKDER SGKEELFKYE GGLRAFVEYL NTNKTPVNEV       240
     FHFNIQRDDG IGVEIALQWN DSFNENLLCF TNNIPQRDGG THLVGFRSAL TRNLNNYIEQ       300
     EGLAKKHKVA TTGDDAREGL TAIISVKVPD PKFSSQTKDK LVSSEVKTAV EQEMGKYFSD       360
     FLLENPNEAK AVVGKMIDAA RAREAARKAR EMTRRKGALD IAGLPGKLAD CQEKDPALSE       420
     LYLVEGDSAG GSAKQGRNRR TQAILPLKGK ILNVEKARFD KMISSQEVGT LITALGCGIG       480
     REEYNIDKLR YHNIIIMTDA DVDGSHIRTL LLTFFFRQLP ELIERGYIYI AQPPLYKVKK       540
     GKQEQYIKDD EAMEEYMTQS ALEDASLHLS ESAPGISGTA LEKLVNDFRM VMKTLKRLSR       600
     LYPQELTEHF VYLPPITLEQ LSDHEGMQAW LALFDARLRT GEKSGLVYKA SLREDRERNV       660
     WLPEVELISH GLSNYVTFNR DFFGSNDYKT VTALGAQIST LLEEGAYVQR GERKKPVNEF       720
     KEALAWLMAE STKRHTIQRY KGLGEMNPDQ LWETTMDPSV RRMLKVTIED AIGADQIFNT       780
     LMGDAVEPRR DFIESNALAV SNLDF                                             805
//

If you have problems or comments...

PBIL Back to PBIL home page