(data stored in ACNUC7421 zone)

EMBL: CP000075.PE40

CP000075.PE40        Location/Qualifiers
FT   CDS             42698..43129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0040"
FT                   /product="OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35114"
FT                   /db_xref="GOA:Q500Q8"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q500Q8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35114.1"
FT                   /translation="MSIVKKASAHWEGDLKSGIGSISTETGVLREAPYGFKARFEGGKG
FT                   TNPEELIGAAHAGCFSMALSMILGGAGLTAESIDTQAEVSLDQVEGGFAISAVHLTLKA
FT                   KVPGATQEKFDELTKQAKEGCPVSKVLNAKITLDATLLS"
     MSIVKKASAH WEGDLKSGIG SISTETGVLR EAPYGFKARF EGGKGTNPEE LIGAAHAGCF        60
     SMALSMILGG AGLTAESIDT QAEVSLDQVE GGFAISAVHL TLKAKVPGAT QEKFDELTKQ       120
     AKEGCPVSKV LNAKITLDAT LLS                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page