(data stored in ACNUC7421 zone)

EMBL: CP000075.PE403

CP000075.PE403       Location/Qualifiers
FT   CDS             433624..434688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0403"
FT                   /product="Type IV pilus assembly protein PilM"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35473"
FT                   /db_xref="GOA:Q4ZZE9"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZE9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35473.1"
FT                   /translation="MFELFSKKANTLLGIDISSTSVKLLELSRSGTRYKVESYAVEPLP
FT                   ANAVVEKNIAELEGVGQALSRVLAKAKTSVKNVAVAVAGSAVITKTIEMDAGLSDDDME
FT                   NQLKLEADQYIPYPLEEVAIDFEVQGYSVRNPERVEVLLAACRKENVEVREAALALAGL
FT                   TARVVDVEAYALERSFGLLAAQLGNGHDELTVAVVDIGATMTTLSVLHHGRIIYTREQL
FT                   FGGRQLTDEIQRRYGLSMEEAGLAKKQGGLPDDYVSEVLDPFKEALVQQVSRSLQFFFA
FT                   AGQYNSVDHIMLAGGTASISGLEHLIQRRIGTPTMVANPFADMALSSKVNAGALASDAP
FT                   ALMIACGLALRSFD"
     MFELFSKKAN TLLGIDISST SVKLLELSRS GTRYKVESYA VEPLPANAVV EKNIAELEGV        60
     GQALSRVLAK AKTSVKNVAV AVAGSAVITK TIEMDAGLSD DDMENQLKLE ADQYIPYPLE       120
     EVAIDFEVQG YSVRNPERVE VLLAACRKEN VEVREAALAL AGLTARVVDV EAYALERSFG       180
     LLAAQLGNGH DELTVAVVDI GATMTTLSVL HHGRIIYTRE QLFGGRQLTD EIQRRYGLSM       240
     EEAGLAKKQG GLPDDYVSEV LDPFKEALVQ QVSRSLQFFF AAGQYNSVDH IMLAGGTASI       300
     SGLEHLIQRR IGTPTMVANP FADMALSSKV NAGALASDAP ALMIACGLAL RSFD             354
//

If you have problems or comments...

PBIL Back to PBIL home page