(data stored in ACNUC7421 zone)

EMBL: CP000075.PE405

CP000075.PE405       Location/Qualifiers
FT   CDS             435260..435883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0405"
FT                   /product="Pilus assembly protein, PilO"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35475"
FT                   /db_xref="GOA:Q4ZZE7"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZE7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35475.1"
FT                   /translation="MNMSEWLEGLRKVDLSELDLNNLGSWPAAIKAIAGVLVAVMIFAL
FT                   GYFFFIQDLETQLESAQGSEVTLKEQFSNKAFQAANLEPYKKQMEEMENTFGALLRQLP
FT                   SDTEVPGLLEDITRTGLGSGLEFEEIKLLPEAAQQFYIELPIQITVVGGYHDLATFVSG
FT                   VASLPRIVTLHDFEIKPVDPKVPTKLRMSILAKTYRYNDEGLKK"
     MNMSEWLEGL RKVDLSELDL NNLGSWPAAI KAIAGVLVAV MIFALGYFFF IQDLETQLES        60
     AQGSEVTLKE QFSNKAFQAA NLEPYKKQME EMENTFGALL RQLPSDTEVP GLLEDITRTG       120
     LGSGLEFEEI KLLPEAAQQF YIELPIQITV VGGYHDLATF VSGVASLPRI VTLHDFEIKP       180
     VDPKVPTKLR MSILAKTYRY NDEGLKK                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page