(data stored in ACNUC7421 zone)

EMBL: CP000075.PE406

CP000075.PE406       Location/Qualifiers
FT   CDS             435880..436407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0406"
FT                   /product="Pilus assembly protein, PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35476"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZE6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35476.1"
FT                   /translation="MRAARLLCVSVVLAGLAGCGNDNDFADLSEFMDQARARPSGNIEP
FT                   LPKFRPYEAFTYNASTLRSPFQPPVKIDLLNRQKGSRLVAPDEHRVKQFLEGFNIESFE
FT                   MVGTIGNESGTFALLRGAGGVHRVKVGDYLGRNNGRVVSIGDAQVDVIEIVPDGEGAWL
FT                   ERPRTIALKERS"
     MRAARLLCVS VVLAGLAGCG NDNDFADLSE FMDQARARPS GNIEPLPKFR PYEAFTYNAS        60
     TLRSPFQPPV KIDLLNRQKG SRLVAPDEHR VKQFLEGFNI ESFEMVGTIG NESGTFALLR       120
     GAGGVHRVKV GDYLGRNNGR VVSIGDAQVD VIEIVPDGEG AWLERPRTIA LKERS            175
//

If you have problems or comments...

PBIL Back to PBIL home page