(data stored in ACNUC7421 zone)

EMBL: CP000075.PE408

CP000075.PE408       Location/Qualifiers
FT   CDS             438565..439083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0408"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35478"
FT                   /db_xref="GOA:Q4ZZE4"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZE4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35478.1"
FT                   /translation="MRNLILVGPMGAGKSTIGRLLAKELRLPFKDSDKEIELRTGANIP
FT                   WIFDKEGEPGFRDREQAMIAELCAADGVVLATGGGAVMRSENRHALRAGGRVVYLHASI
FT                   EQQVGRTARDRNRPLLRTADPARVLSELLAIRDPFYREIADIVIETDERPPRMVVLEIL
FT                   ARLAELPPR"
     MRNLILVGPM GAGKSTIGRL LAKELRLPFK DSDKEIELRT GANIPWIFDK EGEPGFRDRE        60
     QAMIAELCAA DGVVLATGGG AVMRSENRHA LRAGGRVVYL HASIEQQVGR TARDRNRPLL       120
     RTADPARVLS ELLAIRDPFY REIADIVIET DERPPRMVVL EILARLAELP PR               172
//

If you have problems or comments...

PBIL Back to PBIL home page