(data stored in ACNUC7421 zone)

EMBL: CP000075.PE41

CP000075.PE41        Location/Qualifiers
FT   CDS             43248..43481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0041"
FT                   /product="Protein of unknown function DUF1161"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35115"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:Q500Q7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35115.1"
FT                   /translation="MKRFILAATCTLLATSALAAPKSCEELKAEIEAKIQANNVTSYTL
FT                   EIVSNEEATDPSMIVGSCDNGTKKIIYQLNGR"
     MKRFILAATC TLLATSALAA PKSCEELKAE IEAKIQANNV TSYTLEIVSN EEATDPSMIV        60
     GSCDNGTKKI IYQLNGR                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page