(data stored in ACNUC7421 zone)

EMBL: CP000075.PE413

CP000075.PE413       Location/Qualifiers
FT   CDS             448609..451833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35483"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZD9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35483.1"
FT                   /translation="MLKAAPRGKLARSTEQQSLGPDRFTPSSIAVREHRNRERADRIID
FT                   QFVERFTEKDFFPDDGDDALFALLVQLPEWPADLSIRIHNESDEVLAVFLKGSDDSVVQ
FT                   SSILLTLNADAYIAPDDVPISDDEPLLHLIFSQLPVGSDLGTGGNFPGSNSVAGRIVTL
FT                   REQIAGLAKDQRPLLFDALVAANEDVSKSQLDTRTRNPLLPLWVRQQAFLTPALGVLCA
FT                   LCPEVPVARLEELLDQMPLTAQEETGFLERTLLPDAFGEALNISLDEWSSSLAIDGLAR
FT                   TRSFNTYTDELARRLASQLLTDTLGRALVIIEYGMSLYVTPGPDDTSIVLLHDDYGNYR
FT                   AQDTGNGEITSFKEGTDSFYLAISAQLKAEERALLGMQFEQDVKGFRELLTRLAIKENR
FT                   GWFDPGKPTEIESGFLPEWFAAAADVEKHRWKAAVQDYTQALLEAQAPDLLDPSGYGEP
FT                   EQLRNYAREKLRARILLDHGVAVDPDAVIVHTASIEIDPGIIIDTDYTYVGPSEIEPNV
FT                   ETQQRSLTELSLENIAVTDINFLLTGRAFDDHGQLISFLSAGYLFSLIRDLNVGENHVR
FT                   FLNTELLTSTAGQWHRERFASVMRAQMRLDALEAKMAGDFLGDGGLPPELANRGYKWLA
FT                   AVLDHPSEGGDRAAVEGHRIQVSQLSINGVTLNGILLVGAESLSSVASLVVFTPQVPDG
FT                   KCFREMSDAQALQQQVLLEPELLDYLVSRAPLASRGHVRHVLTSGRDTLFMALQPCTGS
FT                   FLDAVYESEVARVISAVDEQTNTTWETNWESAWEITKAVGDIVLTFAPFKVRLPMAALR
FT                   SFYAIWQGVATTADDKASAPLYFVQAALLLADGLALPKGRRVRTPAATSIGRSVLDPRT
FT                   AVARIPGGLKLRDDGFYKGVYEKSREDAPSRFYAVQHDKAYAVRYDADSAVWRVIDPRR
FT                   PDAYYQLPIQLDRQNVWVHASAGLRGGKKHSKPKSSSGSGSDSGSPDNGNRVRRYKVDL
FT                   EGFFESRNFKNAQKNIEDDLVVAVRKATERFELDGNGSLHKHGKTGFSLDLPGVGRSTG
FT                   RGAWRLILEPGEKGIIRAVDVKDPHK"
     MLKAAPRGKL ARSTEQQSLG PDRFTPSSIA VREHRNRERA DRIIDQFVER FTEKDFFPDD        60
     GDDALFALLV QLPEWPADLS IRIHNESDEV LAVFLKGSDD SVVQSSILLT LNADAYIAPD       120
     DVPISDDEPL LHLIFSQLPV GSDLGTGGNF PGSNSVAGRI VTLREQIAGL AKDQRPLLFD       180
     ALVAANEDVS KSQLDTRTRN PLLPLWVRQQ AFLTPALGVL CALCPEVPVA RLEELLDQMP       240
     LTAQEETGFL ERTLLPDAFG EALNISLDEW SSSLAIDGLA RTRSFNTYTD ELARRLASQL       300
     LTDTLGRALV IIEYGMSLYV TPGPDDTSIV LLHDDYGNYR AQDTGNGEIT SFKEGTDSFY       360
     LAISAQLKAE ERALLGMQFE QDVKGFRELL TRLAIKENRG WFDPGKPTEI ESGFLPEWFA       420
     AAADVEKHRW KAAVQDYTQA LLEAQAPDLL DPSGYGEPEQ LRNYAREKLR ARILLDHGVA       480
     VDPDAVIVHT ASIEIDPGII IDTDYTYVGP SEIEPNVETQ QRSLTELSLE NIAVTDINFL       540
     LTGRAFDDHG QLISFLSAGY LFSLIRDLNV GENHVRFLNT ELLTSTAGQW HRERFASVMR       600
     AQMRLDALEA KMAGDFLGDG GLPPELANRG YKWLAAVLDH PSEGGDRAAV EGHRIQVSQL       660
     SINGVTLNGI LLVGAESLSS VASLVVFTPQ VPDGKCFREM SDAQALQQQV LLEPELLDYL       720
     VSRAPLASRG HVRHVLTSGR DTLFMALQPC TGSFLDAVYE SEVARVISAV DEQTNTTWET       780
     NWESAWEITK AVGDIVLTFA PFKVRLPMAA LRSFYAIWQG VATTADDKAS APLYFVQAAL       840
     LLADGLALPK GRRVRTPAAT SIGRSVLDPR TAVARIPGGL KLRDDGFYKG VYEKSREDAP       900
     SRFYAVQHDK AYAVRYDADS AVWRVIDPRR PDAYYQLPIQ LDRQNVWVHA SAGLRGGKKH       960
     SKPKSSSGSG SDSGSPDNGN RVRRYKVDLE GFFESRNFKN AQKNIEDDLV VAVRKATERF      1020
     ELDGNGSLHK HGKTGFSLDL PGVGRSTGRG AWRLILEPGE KGIIRAVDVK DPHK            1074
//

If you have problems or comments...

PBIL Back to PBIL home page