(data stored in SCRATCH zone)

EMBL: CP000075.PE418

CP000075.PE418       Location/Qualifiers
FT   CDS             complement(457049..457696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0418"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35488"
FT                   /db_xref="GOA:Q4ZZD4"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR013467"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZD4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35488.1"
FT                   /translation="MRRIIKGTEPASFTEWKASANEDWTPTYPTLQNPQKRDLHDRLLQ
FT                   EQNFSCCYCGREIELDSSHIEHFRPQDHYLPLALEFSNLHASCLRETTPGSPLHCGHYK
FT                   GNWFDEDLHISPTEDDCEQRFRYLLTGKIQSTSHTDLPATTMIEKLALDIAYLTKRRQE
FT                   AITGVFDEQFISSASDAELANLVDSLRSGTANTSIAFGHVVARYAEQLLTQR"
     MRRIIKGTEP ASFTEWKASA NEDWTPTYPT LQNPQKRDLH DRLLQEQNFS CCYCGREIEL        60
     DSSHIEHFRP QDHYLPLALE FSNLHASCLR ETTPGSPLHC GHYKGNWFDE DLHISPTEDD       120
     CEQRFRYLLT GKIQSTSHTD LPATTMIEKL ALDIAYLTKR RQEAITGVFD EQFISSASDA       180
     ELANLVDSLR SGTANTSIAF GHVVARYAEQ LLTQR                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page