(data stored in ACNUC7421 zone)

EMBL: CP000075.PE419

CP000075.PE419       Location/Qualifiers
FT   CDS             complement(457693..458958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0419"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35489"
FT                   /db_xref="GOA:Q4ZZD3"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZD3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35489.1"
FT                   /translation="MRLDRLHLQNFRCYEDAHFDFQPGFNLVVGVNGSGKTSLLLGVAG
FT                   CFGNLLGSIGVHRPSIAESDVRFELVKFEDRIRFERSYPLVLTAQGGAFEHQEWHVSLE
FT                   RSSLQTNFSALNSLVFSENLISIDGATHGDLPVFAVYQANRRWLTMSVTAEHAAQSKPS
FT                   RLDAYTSWFDAASNLKNFETWFIGKTLERFQRLARTGFPGILTDELTWINSAIQCALPE
FT                   SKGIEYDMEMRGLMVDIDDRKTPFNDLSDGQRGMVALFADIARRICLLNPHMGKDVLSK
FT                   TNGIIVIDELDIHLHPGWQRTIAPALKKAFPSIQFIAASHSPQVIGSLQPGEVILLNNH
FT                   DGSHPRATYGLDSSSILEEVMGVPQREPEIEELLDQLFSTLENNELEKARSQLDALKKK
FT                   APDLPEFAGAEALLKRKEIIGR"
     MRLDRLHLQN FRCYEDAHFD FQPGFNLVVG VNGSGKTSLL LGVAGCFGNL LGSIGVHRPS        60
     IAESDVRFEL VKFEDRIRFE RSYPLVLTAQ GGAFEHQEWH VSLERSSLQT NFSALNSLVF       120
     SENLISIDGA THGDLPVFAV YQANRRWLTM SVTAEHAAQS KPSRLDAYTS WFDAASNLKN       180
     FETWFIGKTL ERFQRLARTG FPGILTDELT WINSAIQCAL PESKGIEYDM EMRGLMVDID       240
     DRKTPFNDLS DGQRGMVALF ADIARRICLL NPHMGKDVLS KTNGIIVIDE LDIHLHPGWQ       300
     RTIAPALKKA FPSIQFIAAS HSPQVIGSLQ PGEVILLNNH DGSHPRATYG LDSSSILEEV       360
     MGVPQREPEI EELLDQLFST LENNELEKAR SQLDALKKKA PDLPEFAGAE ALLKRKEIIG       420
     R                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page