(data stored in ACNUC7421 zone)

EMBL: CP000075.PE428

CP000075.PE428       Location/Qualifiers
FT   CDS             complement(466353..467600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0428"
FT                   /product="Monooxygenase, FAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35498"
FT                   /db_xref="GOA:Q4ZZC4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZC4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35498.1"
FT                   /translation="MPITDREIRQVVVIGAGPAGSIAAALLKRQGHDVLIIERQLFPRF
FT                   SIGESLLCHCLDFVEEAGMLEAVQAAGFQPKNGAAFARGEQYSDFDFGDTFSNGRPTTF
FT                   QVQRSEFDKLLADQAALQGVEIRYQEEIVSADFDGPQPVLRVRREDGSEYSVQASFVLD
FT                   ASGYGRVLPRLLDLEAPSGFPVRQAVFTHIQDRIESPPFDRRKILVSIHPQHSDVWFWS
FT                   IPFSEGRCSIGVVASAERFKDKPEDLDACLRTFIAETPQLASVLKNAVWDTPARTIGGY
FT                   SANVKTLHGKGFALLGNAAEFLDPVFSSGVTIAMRSASMAAGVLSRQLQGENVDWESEF
FT                   AVPLKRGVDTFRAYVEGWYDGTFQNVIFYPGSAPDIRRMISSILAGYAWDERNPFVSEP
FT                   KRRLRTLSEICAGSGS"
     MPITDREIRQ VVVIGAGPAG SIAAALLKRQ GHDVLIIERQ LFPRFSIGES LLCHCLDFVE        60
     EAGMLEAVQA AGFQPKNGAA FARGEQYSDF DFGDTFSNGR PTTFQVQRSE FDKLLADQAA       120
     LQGVEIRYQE EIVSADFDGP QPVLRVRRED GSEYSVQASF VLDASGYGRV LPRLLDLEAP       180
     SGFPVRQAVF THIQDRIESP PFDRRKILVS IHPQHSDVWF WSIPFSEGRC SIGVVASAER       240
     FKDKPEDLDA CLRTFIAETP QLASVLKNAV WDTPARTIGG YSANVKTLHG KGFALLGNAA       300
     EFLDPVFSSG VTIAMRSASM AAGVLSRQLQ GENVDWESEF AVPLKRGVDT FRAYVEGWYD       360
     GTFQNVIFYP GSAPDIRRMI SSILAGYAWD ERNPFVSEPK RRLRTLSEIC AGSGS            415
//

If you have problems or comments...

PBIL Back to PBIL home page