(data stored in ACNUC7421 zone)

EMBL: CP000075.PE43

CP000075.PE43        Location/Qualifiers
FT   CDS             44004..45059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35117"
FT                   /db_xref="InterPro:IPR014553"
FT                   /db_xref="UniProtKB/TrEMBL:Q500Q5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35117.1"
FT                   /translation="MATFALPRLRHLLALTAVTLLTGCSSVSYYSQLAQGQWQLLQARE
FT                   PVEKIIADPTRDAGLRRHLAQSQLARAFASEHLHLPDNKSYRLYADLGRPYVVWNVFAT
FT                   DEFSLEPVTHCFPIAGCVAYRGYYSPGGARGEAALQRQAGKDVYLSGVEAYSTLGWFND
FT                   PILSSMMGWGDERLATLIFHELAHQRFYVKDDTEFNESYASFVEQEGTRQWRAARGLPP
FT                   ESVSQSARRDQFTRLVLDTRERLKALYRQPLSAEVMRARKAEEFERMRRDYRALRDEQW
FT                   AGDKRFDAWINSPMNNAKLLPFGLYDQWVPAFETLFRQENGDWQAFYRAVEKLGGMPAE
FT                   ARKAALQALMP"
     MATFALPRLR HLLALTAVTL LTGCSSVSYY SQLAQGQWQL LQAREPVEKI IADPTRDAGL        60
     RRHLAQSQLA RAFASEHLHL PDNKSYRLYA DLGRPYVVWN VFATDEFSLE PVTHCFPIAG       120
     CVAYRGYYSP GGARGEAALQ RQAGKDVYLS GVEAYSTLGW FNDPILSSMM GWGDERLATL       180
     IFHELAHQRF YVKDDTEFNE SYASFVEQEG TRQWRAARGL PPESVSQSAR RDQFTRLVLD       240
     TRERLKALYR QPLSAEVMRA RKAEEFERMR RDYRALRDEQ WAGDKRFDAW INSPMNNAKL       300
     LPFGLYDQWV PAFETLFRQE NGDWQAFYRA VEKLGGMPAE ARKAALQALM P                351
//

If you have problems or comments...

PBIL Back to PBIL home page