(data stored in SCRATCH zone)

EMBL: CP000075.PE430

CP000075.PE430       Location/Qualifiers
FT   CDS             complement(470002..470616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35500"
FT                   /db_xref="GOA:Q4ZZC2"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZC2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35500.1"
FT                   /translation="MNRPLRTLILLGLLCLSSLAQAFDLQQLSDQLAKPAVVQGRFVQE
FT                   KHLRALPQPLLSKGRFVLARDFGLLWLLETPLKQDYRINADGIARRETAGNVSTWKPVP
FT                   NKNAGAEQNRLFLAVLQGDSSGLQRDFDLQLKGEATAWHLTLTPRSMLLQQVFKQINID
FT                   GGELVQRIELLETQGDSTVLKMIDSSSATTLTDAQRNDFKD"
     MNRPLRTLIL LGLLCLSSLA QAFDLQQLSD QLAKPAVVQG RFVQEKHLRA LPQPLLSKGR        60
     FVLARDFGLL WLLETPLKQD YRINADGIAR RETAGNVSTW KPVPNKNAGA EQNRLFLAVL       120
     QGDSSGLQRD FDLQLKGEAT AWHLTLTPRS MLLQQVFKQI NIDGGELVQR IELLETQGDS       180
     TVLKMIDSSS ATTLTDAQRN DFKD                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page