(data stored in ACNUC7421 zone)

EMBL: CP000075.PE432

CP000075.PE432       Location/Qualifiers
FT   CDS             complement(471117..472064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0432"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35502"
FT                   /db_xref="GOA:Q4ZZC0"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR014548"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZC0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35502.1"
FT                   /translation="MSIDKSPREHWASHQERGSFMLMKLTAWGMRVLGRRLLSPVLYGI
FT                   VLYFFVFGRRARHSIWQYQQHLADWSGKPELRPGQRRVFGQFMAFADALLDKLDVWNGR
FT                   LGIDQIEIVDQALLRQNLRGQRGQMLVGAHLGNLEVCRALAELGEKVTMNVLVHTKHAE
FT                   RFNRLLGEAGATHLRLIQVSELDPAIMLQLSQRLDEGEWLAIAGDRVALHGGRNVRVDF
FT                   LGQPANFPQGPWLLAGLLKCPVNLFFCLKGAKGYRVILEPFADAIEWRRSDRAQVIEQW
FT                   ATRYAERLGHYCLEAPQQWFNFYPFWKSADESGS"
     MSIDKSPREH WASHQERGSF MLMKLTAWGM RVLGRRLLSP VLYGIVLYFF VFGRRARHSI        60
     WQYQQHLADW SGKPELRPGQ RRVFGQFMAF ADALLDKLDV WNGRLGIDQI EIVDQALLRQ       120
     NLRGQRGQML VGAHLGNLEV CRALAELGEK VTMNVLVHTK HAERFNRLLG EAGATHLRLI       180
     QVSELDPAIM LQLSQRLDEG EWLAIAGDRV ALHGGRNVRV DFLGQPANFP QGPWLLAGLL       240
     KCPVNLFFCL KGAKGYRVIL EPFADAIEWR RSDRAQVIEQ WATRYAERLG HYCLEAPQQW       300
     FNFYPFWKSA DESGS                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page