(data stored in ACNUC7421 zone)

EMBL: CP000075.PE435

CP000075.PE435       Location/Qualifiers
FT   CDS             complement(474481..475026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0435"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35505"
FT                   /db_xref="GOA:Q4ZZB7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZB7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35505.1"
FT                   /translation="MKRLIGLILVLAGVLYPFAVYWGTEHFAPWQFALLLGSLWLARAL
FT                   TGERRQGSLAMAIVALIFCVVLGALDSHMMLRWYPVLVSTFMLGLFGSSLVYGPPIVEK
FT                   MARLNRPDLPEAGIRYTRKVTQIWCLFFLVNGLTSAILTLWAPLSWWTLYTGLISYGLM
FT                   GVLFAVEWIVRPPSAGGK"
     MKRLIGLILV LAGVLYPFAV YWGTEHFAPW QFALLLGSLW LARALTGERR QGSLAMAIVA        60
     LIFCVVLGAL DSHMMLRWYP VLVSTFMLGL FGSSLVYGPP IVEKMARLNR PDLPEAGIRY       120
     TRKVTQIWCL FFLVNGLTSA ILTLWAPLSW WTLYTGLISY GLMGVLFAVE WIVRPPSAGG       180
     K                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page