(data stored in ACNUC7421 zone)

EMBL: CP000075.PE436

CP000075.PE436       Location/Qualifiers
FT   CDS             complement(475023..475277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0436"
FT                   /product="Phosphopantetheine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35506"
FT                   /db_xref="GOA:Q4ZZB6"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZB6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35506.1"
FT                   /translation="MQTREDIFEILRAAMVELFELEPERVTLEANLYQDLEIDSIDAVD
FT                   LIDHIKRKTGKKIAAEEFKSVRTVKDVVEAVYKLVNTAE"
     MQTREDIFEI LRAAMVELFE LEPERVTLEA NLYQDLEIDS IDAVDLIDHI KRKTGKKIAA        60
     EEFKSVRTVK DVVEAVYKLV NTAE                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page