(data stored in ACNUC7421 zone)

EMBL: CP000075.PE439

CP000075.PE439       Location/Qualifiers
FT   CDS             complement(476310..477029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0439"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35509"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZB3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35509.1"
FT                   /translation="MITFNIARWQAWAPGLASAEDWQRWSLDPTLLETSDAAPDVSFLP
FT                   AMQRRRLGRMARMAFAVGWPLTEGLGRVPLVFVSRHGETPRTFEILRDLAANEPLSPTQ
FT                   FSLSVHNAVIGLWSIMRGETSEMTALAATGDGLEYGAFEAAALLAEGAEAVLLVVTEEQ
FT                   PPQAYAQWIDDVPFPYAVGLLLTPGNEWQLSLNTDTQGTTRTQWPHALNLLRALHTDQS
FT                   VCLHPWNNRLWNWQRSH"
     MITFNIARWQ AWAPGLASAE DWQRWSLDPT LLETSDAAPD VSFLPAMQRR RLGRMARMAF        60
     AVGWPLTEGL GRVPLVFVSR HGETPRTFEI LRDLAANEPL SPTQFSLSVH NAVIGLWSIM       120
     RGETSEMTAL AATGDGLEYG AFEAAALLAE GAEAVLLVVT EEQPPQAYAQ WIDDVPFPYA       180
     VGLLLTPGNE WQLSLNTDTQ GTTRTQWPHA LNLLRALHTD QSVCLHPWNN RLWNWQRSH        239
//

If you have problems or comments...

PBIL Back to PBIL home page