(data stored in ACNUC7421 zone)

EMBL: CP000075.PE441

CP000075.PE441       Location/Qualifiers
FT   CDS             complement(478811..479206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0441"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35511"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZB1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35511.1"
FT                   /translation="MSFIVREGDLTTTGGFVLAASASEVIERRRVARMGDPVWCPACRE
FT                   IGFIAQGNPTYIDELVAVATQGHEVQCGCEPGSNTLTTSQEHVQADMDATITIPEELAN
FT                   TARQNAEHLARSMKDGSFTPDVLRPLT"
     MSFIVREGDL TTTGGFVLAA SASEVIERRR VARMGDPVWC PACREIGFIA QGNPTYIDEL        60
     VAVATQGHEV QCGCEPGSNT LTTSQEHVQA DMDATITIPE ELANTARQNA EHLARSMKDG       120
     SFTPDVLRPL T                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page