(data stored in SCRATCH zone)

EMBL: CP000075.PE445

CP000075.PE445       Location/Qualifiers
FT   CDS             482458..483309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0445"
FT                   /product="malonate decarboxylase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35515"
FT                   /db_xref="GOA:Q4ZZA7"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR017556"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZA7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35515.1"
FT                   /translation="MTDNARLLNQHSFIELGARQRARALLDAGSFRELLGPFDRVMSPW
FT                   LAMQGVVPQADDGVVVGKGTVDGRPVVIAAIEGSFQGGSMGEVGGAKMAGALELAAEDN
FT                   RNGIPTAAIVLLETGGVRLQEANLGLAAIAEIHAAIVDLRQYQPVIGVVAGSVGCFGGM
FT                   SIAAGLCSYLLVTQEARLGLNGPQVIEQEAGIEEYDSRDRPFIWSLTGGEQRFASALVD
FT                   GFAADDVADVRQQVSGWLKQGVPDTHRSSQYPLFLQRLASLDTEPQIDPQSVRTLYQGA
FT                   RS"
     MTDNARLLNQ HSFIELGARQ RARALLDAGS FRELLGPFDR VMSPWLAMQG VVPQADDGVV        60
     VGKGTVDGRP VVIAAIEGSF QGGSMGEVGG AKMAGALELA AEDNRNGIPT AAIVLLETGG       120
     VRLQEANLGL AAIAEIHAAI VDLRQYQPVI GVVAGSVGCF GGMSIAAGLC SYLLVTQEAR       180
     LGLNGPQVIE QEAGIEEYDS RDRPFIWSLT GGEQRFASAL VDGFAADDVA DVRQQVSGWL       240
     KQGVPDTHRS SQYPLFLQRL ASLDTEPQID PQSVRTLYQG ARS                         283
//

If you have problems or comments...

PBIL Back to PBIL home page