(data stored in ACNUC7421 zone)

EMBL: CP000075.PE446

CP000075.PE446       Location/Qualifiers
FT   CDS             483306..484106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0446"
FT                   /product="Malonate decarboxylase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35516"
FT                   /db_xref="GOA:Q4ZZA6"
FT                   /db_xref="InterPro:IPR009648"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZA6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35516.1"
FT                   /translation="MSHSQRGLNWFNALSAGAREVTGLPASLKVADGVLGEQPVRFLAV
FT                   IADTDNCFPRARQGEVGLLEGWGLAKAVDEAIEQDRDRAEKRALIAIVDVPSQAYGRRE
FT                   EALGIHQALAGAVDSYARARLAGHPVIGLLVGKAMSGAFLAHGYQANRLIALRDPGVMV
FT                   HAMGKASAARVTLRSVEDLEKLAASIPPMAYDIDSYASLGLLWETLTVKQIEQPAADDL
FT                   VQVRNVLSSAIKDVQARGVDLSSRLGASNRAASVNVRQLLRAQW"
     MSHSQRGLNW FNALSAGARE VTGLPASLKV ADGVLGEQPV RFLAVIADTD NCFPRARQGE        60
     VGLLEGWGLA KAVDEAIEQD RDRAEKRALI AIVDVPSQAY GRREEALGIH QALAGAVDSY       120
     ARARLAGHPV IGLLVGKAMS GAFLAHGYQA NRLIALRDPG VMVHAMGKAS AARVTLRSVE       180
     DLEKLAASIP PMAYDIDSYA SLGLLWETLT VKQIEQPAAD DLVQVRNVLS SAIKDVQARG       240
     VDLSSRLGAS NRAASVNVRQ LLRAQW                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page