(data stored in ACNUC7421 zone)

EMBL: CP000075.PE46

CP000075.PE46        Location/Qualifiers
FT   CDS             47937..48227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0046"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35120"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:Q500Q2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35120.1"
FT                   /translation="MTDTPVVITRKRFIAGAVCPACSEPDKLMMWNENDVPHRECVSCG
FT                   YSDTLNEQGISIPKELGTRVNKVVVKPADPKVQGVQFFPNPKLKKPVDLSD"
     MTDTPVVITR KRFIAGAVCP ACSEPDKLMM WNENDVPHRE CVSCGYSDTL NEQGISIPKE        60
     LGTRVNKVVV KPADPKVQGV QFFPNPKLKK PVDLSD                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page