(data stored in ACNUC7421 zone)

EMBL: CP000075.PE464

CP000075.PE464       Location/Qualifiers
FT   CDS             complement(502892..503530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35534"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ88"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35534.1"
FT                   /translation="MIDENALRQEICDVGRLLYGRGYTVGSAGNISARLDDGWLITPTD
FT                   ACLGRMDPADIAKVNLAGEWVSGSKPSKTLALHREVYDRNPQVGGVVHTHSTHLVALTL
FT                   AGVWQEDDILPPLTPYQVMKVGHIPLIPYERPGSPKVAERVAELANSVRGVMLERLGPV
FT                   VWESSVAKACYALEELEETARLWLMSNPKPAPLAPAALEELRQVFDARW"
     MIDENALRQE ICDVGRLLYG RGYTVGSAGN ISARLDDGWL ITPTDACLGR MDPADIAKVN        60
     LAGEWVSGSK PSKTLALHRE VYDRNPQVGG VVHTHSTHLV ALTLAGVWQE DDILPPLTPY       120
     QVMKVGHIPL IPYERPGSPK VAERVAELAN SVRGVMLERL GPVVWESSVA KACYALEELE       180
     ETARLWLMSN PKPAPLAPAA LEELRQVFDA RW                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page