(data stored in ACNUC7421 zone)

EMBL: CP000075.PE465

CP000075.PE465       Location/Qualifiers
FT   CDS             complement(503530..504819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0465"
FT                   /product="HopAN1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35535"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ87"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35535.1"
FT                   /translation="MSLNNARPLLGCIADDFTGATDLANMLVRGGMRTVQSIGIPSAEM
FT                   AAGLDADAIVIALKSRTTPSAEAVAESLAALEWLRERGCEQIFFKYCSTFDSTAAGNIG
FT                   QVSEALLEQLGSDFTLACPAFPENGRTIFRGHLFVQDQLLSESGMQNHPLTPMTDANLV
FT                   RVLQAQTSHKVGLLRYDSIAQGVEGVRNRIAELRAEGVSMAIADALSDADLYTLGEACA
FT                   DLPLLTGGSGLALGLPGNFRKAGKLRDIDAAKQVAISGGEVVLAGSASVATNGQVAAWL
FT                   EADRPALRINPLELAAGKPVVEQALAFARDAGQTVLIYATSTPDEVKAVQQELGVERSG
FT                   AMVEAALGEIAKGLLDAGVRRFVVAGGETSGAVVQALGVQLLQIGAQIDPGVPATVSSG
FT                   AQPLALALKSGNFGARDFFAKALKQLAGAA"
     MSLNNARPLL GCIADDFTGA TDLANMLVRG GMRTVQSIGI PSAEMAAGLD ADAIVIALKS        60
     RTTPSAEAVA ESLAALEWLR ERGCEQIFFK YCSTFDSTAA GNIGQVSEAL LEQLGSDFTL       120
     ACPAFPENGR TIFRGHLFVQ DQLLSESGMQ NHPLTPMTDA NLVRVLQAQT SHKVGLLRYD       180
     SIAQGVEGVR NRIAELRAEG VSMAIADALS DADLYTLGEA CADLPLLTGG SGLALGLPGN       240
     FRKAGKLRDI DAAKQVAISG GEVVLAGSAS VATNGQVAAW LEADRPALRI NPLELAAGKP       300
     VVEQALAFAR DAGQTVLIYA TSTPDEVKAV QQELGVERSG AMVEAALGEI AKGLLDAGVR       360
     RFVVAGGETS GAVVQALGVQ LLQIGAQIDP GVPATVSSGA QPLALALKSG NFGARDFFAK       420
     ALKQLAGAA                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page