(data stored in ACNUC7421 zone)

EMBL: CP000075.PE47

CP000075.PE47        Location/Qualifiers
FT   CDS             complement(48272..48574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35121"
FT                   /db_xref="UniProtKB/TrEMBL:Q500Q1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35121.1"
FT                   /translation="MANYEIRLSMEDFEGDGIPEILVQHWNGDEMDGMAYVTASDKYKG
FT                   FDTVKSGADINEDGVTNTQDITAILALAQAYAVMNLSIKPKEEKTNDTGTEEPVN"
     MANYEIRLSM EDFEGDGIPE ILVQHWNGDE MDGMAYVTAS DKYKGFDTVK SGADINEDGV        60
     TNTQDITAIL ALAQAYAVMN LSIKPKEEKT NDTGTEEPVN                             100
//

If you have problems or comments...

PBIL Back to PBIL home page