(data stored in ACNUC7421 zone)

EMBL: CP000075.PE475

CP000075.PE475       Location/Qualifiers
FT   CDS             complement(514265..514855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0475"
FT                   /product="Protein of unknown function YGGT"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35545"
FT                   /db_xref="GOA:Q4ZZ77"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ77"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35545.1"
FT                   /translation="MIGLNTAAIYVLQTLGSLYLLIVLLRFVLQLVRANFYNPLCQFIV
FT                   RATQPLLKPLRRIIPSLFGLDMSSLVLAIIVQMILMALTLLLMFGTTGDPLHLLLWSII
FT                   GVTALFLKIFFFALIISVILSWVAPGSHNPGAELVNQICEPALAPFRKIVPNLGGLDIS
FT                   PILAFLVLKLLDMLVINNLAAMSNMPDVLRLLM"
     MIGLNTAAIY VLQTLGSLYL LIVLLRFVLQ LVRANFYNPL CQFIVRATQP LLKPLRRIIP        60
     SLFGLDMSSL VLAIIVQMIL MALTLLLMFG TTGDPLHLLL WSIIGVTALF LKIFFFALII       120
     SVILSWVAPG SHNPGAELVN QICEPALAPF RKIVPNLGGL DISPILAFLV LKLLDMLVIN       180
     NLAAMSNMPD VLRLLM                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page